SPATA19 Polyclonal antibody

• 

  WB analysis of human testis using 16656-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 16656-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 16656-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 16656-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human skin using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human liver using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human spleen using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human ovary using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human placenta using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human placenta using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of mouse testis using 16656-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SPATA19 antibody (16656-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse testis using 16656-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SPATA19 antibody (16656-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

SPATA19 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16656-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Spermatogenesis-associated protein 19, mitochondrial, spermatogenesis associated 19, Spergen-1, SPERGEN1, Spergen 1

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue
• Positive IHC detected in: human testis tissue, human liver tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

16656-1-AP targets SPATA19 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10108

  Product name: Recombinant human SPATA19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC058039

  Sequence: MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC

• Full Name: spermatogenesis associated 19
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC058039
• Gene Symbol: SPATA19
• Gene ID (NCBI): 219938
• RRID: AB_1851668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z5L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis; Authors -
mouse	WB,IF	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis.; Authors - Xiaoli Wang