SPATA19 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPATA19 Polyclonal antibody (16656-1-AP)

SPATA19 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16656-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Spermatogenesis-associated protein 19, mitochondrial, spermatogenesis associated 19, Spergen-1, SPERGEN1, Spergen 1

• 

  WB analysis of human testis using 16656-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 16656-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 16656-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 16656-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 16656-1-AP (SPATA19 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16656-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16656-1-AP (SPATA19 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 16656-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SPATA19 antibody (16656-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 16656-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SPATA19 antibody (16656-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPATA19 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue
• Positive IHC detected in: human testis tissue, human liver tissue, human lung tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16656-1-AP targets SPATA19 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10108

  Product name: Recombinant human SPATA19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC058039

  Sequence: MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC

• Full Name: spermatogenesis associated 19
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC058039
• Gene Symbol: SPATA19
• Gene ID (NCBI): 219938
• RRID: AB_1851668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z5L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SPATA19 Polyclonal antibody (catalog #16656-1-AP) has 3 total citations. These appear in the journals Development (2 citations) and Reproduction (1 citation). The associated research fields center on reproductive biology, specifically male germ cell development, spermatogenesis, and mRNA fate/translational regulation in mice. Applications used include Western blotting (WB) and immunofluorescence (IF).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis; Authors -
mouse	WB,IF	Development; MFN2 interacts with nuage-associated proteins and is essential for male germ cell development by controlling mRNA fate during spermatogenesis.; Authors - Xiaoli Wang
mouse	IF	Reproduction; The late chromatoid body component TSSK2 is involved in translational regulation in elongating spermatids in mice.; Authors - Mari S Lehti