SPATA20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATA20 Polyclonal antibody, PBS Only (18373-1-PBS)

• 

  WB analysis of rat testis using 18373-1-AP (same clone as 18373-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 18373-1-AP (SPATA20 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18373-1-PBS in a different storage buffer formulation.

SPATA20 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18373-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18373-1-PBS targets SPATA20 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13234

  Product name: Recombinant human SPATA20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC025255

  Sequence: MLGARAWLGRVLLLPRAGAGLAASRRCPGVWPRTWPHRSPSRGSSSRDKDRSATVSSSVPMPAGGKGSHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKM

• Full Name: spermatogenesis associated 20
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 80-88 kDa
• GenBank Accession Number: BC025255
• Gene Symbol: SPATA20
• Gene ID (NCBI): 64847
• RRID: AB_2878538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TB22
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.