SPATA5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATA5 Polyclonal antibody, PBS Only (32104-1-PBS)

• 

  WB analysis using 32104-1-AP (same clone as 32104-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32104-1-AP (SPATA5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32104-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 32104-1-AP (same clone as 32104-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 32104-1-AP (SPATA5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32104-1-PBS in a different storage buffer formulation.

SPATA5 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 32104-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

AFG2 AAA ATPase homolog A, AFG2A, ATPase family gene 2 protein homolog A, EC:3.6.4.10, Ribosome biogenesis protein SPATA5

---

Product Information

32104-1-PBS targets SPATA5 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36838

  Product name: Recombinant human SPATA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-300 aa of BC048217

  Sequence: WPMAGFPGGKVGLSEMAQKNVGVRPGDAIQVQPLVGAVLQAEEMDVALSDKDMEINEEELTGCILRKLDGKIVLPGNFLYCTFYGRPYKLQVLRVKGADGMILGGPQSDSDTDAQRMAFEQSSMETSSLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNE

• Full Name: spermatogenesis associated 5
• Calculated Molecular Weight: 97, 86, 75 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC048217
• Gene Symbol: SPATA5
• Gene ID (NCBI): 166378
• RRID: AB_3670193
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NB90
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AAA+ ATPases SPATA5 is an ATP-dependent chaperone part of the 55LCC heterohexameric ATPase complex which is chromatin-associated and promotes replisome proteostasis to maintain replication fork progression and genome stability (PubMed:38554706). SPATA5 plays an essential role in the cytoplasmic maturation steps of pre-60S ribosomal particles by promoting the release of shuttling protein RSL24D1/RLP24 from the pre-ribosomal particles (PubMed:35354024, PubMed:38554706).