SPATA5L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATA5L1 Polyclonal antibody, PBS Only (18414-1-PBS)

• 

  WB analysis using 18414-1-AP (same clone as 18414-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18414-1-AP (SPATA5L1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18414-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18414-1-AP (same clone as 18414-1-PBS)

  WB result of SPATA5L1 antibody (18414-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPATA5L1 transfected HeLa cells. This data was developed using the same antibody clone with 18414-1-PBS in a different storage buffer formulation.

SPATA5L1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18414-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18414-1-PBS targets SPATA5L1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13269

  Product name: Recombinant human SPATA5L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC000981

  Sequence: MAPDSDPFPEGPLLKLLPLDARDRGTQRCRLGPAALHALGARLGSAVKISLPDGGSCLCTAWPRRDGADGFVQLDPLCASPGAAVGASRSRRSLSLNRLLLVPCPPLRRVAVWPVLRERAGAPGARNTAAVLEAAQELLRNRPISLGHVVVAPPGAPGLVAALHIVGGTPSPDPAGLVTPRTRVSLGGEPPSEAQPQPEVPLGGLSEAADSLRELLRLPLRYPRALTALGLAVPRGVLLAGPPGVGKTQLVQAVAREAGAELLAVSAPALQGSRPGETEENVRRVFQRARELASRGPSLLFLDEMDALCPQRGSRAPESRVVAQVLTLLDGASGDREVVVVGATNRPDALD

• Full Name: spermatogenesis associated 5-like 1
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC000981
• Gene Symbol: SPATA5L1
• Gene ID (NCBI): 79029
• RRID: AB_2918062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVQ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPATA5L1 (Spermatogenesis-associated protein 5-like protein 1) belongs to the AAA+ATPase protein superfamily. A full-length SPATA5L1 transcript and a short SPATA5L1 variant can be produced in human by alternative splicing. Bi-allelic SPATA5L1 variants lead to a human disease characterized by sensorineural hearing loss with or without a nonprogressive mixed neurodevelopmental phenotype. And immunofluorescence analysis in rat hippocampal neurons demonstrated that SPATA5L1 was located in neuronal and glial cell nuclei, with more prominent expression in neurons (PubMed:34626583). SPATA5L1 also has 3 isoforms.