SPATA9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATA9 Polyclonal antibody, PBS Only (28077-1-PBS)

• 

  WB analysis using 28077-1-AP (same clone as 28077-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28077-1-AP (SPATA9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28077-1-PBS in a different storage buffer formulation.

SPATA9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28077-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

28077-1-PBS targets SPATA9 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27877

  Product name: Recombinant human SPATA9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-132 aa of BC047333

  Sequence: NFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSL

• Full Name: spermatogenesis associated 9
• Calculated Molecular Weight: 254 aa, 29 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC047333
• Gene Symbol: SPATA9
• Gene ID (NCBI): 83890
• RRID: AB_3669641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.