SPATS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPATS2 Polyclonal antibody, PBS Only (32517-1-PBS)

• 

  WB analysis using 32517-1-AP (same clone as 32517-1-PBS)

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 32517-1-AP (SPATS2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32517-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32517-1-AP (same clone as 32517-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32517-1-AP (SPATS2 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32517-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 32517-1-AP (same clone as 32517-1-PBS)

  IP result of anti-SPATS2 (IP:32517-1-AP, 4ug; Detection:32517-1-AP 1:5000) with HeLa cells lysate 1400 ug. This data was developed using the same antibody clone with 32517-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 32517-1-AP (same clone as 32517-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using SPATS2 antibody (32517-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green). This data was developed using the same antibody clone with 32517-1-PBS in a different storage buffer formulation.

SPATS2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 32517-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Nbla00526, p59scr, SCR59, Serine-rich spermatocytes and round spermatid 59 kDa protein, SPATA10

---

Product Information

32517-1-PBS targets SPATS2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38507

  Product name: Recombinant human SPATS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 94-240 aa of NM_001293285.1

  Sequence: NKPKPAAEPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAINDTESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLSRPTTETQFSNMGMEDVPLATSKKLSSNIEK

• Full Name: spermatogenesis associated, serine-rich 2
• Calculated Molecular Weight: 60kDa，545aa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001293285.1
• Gene Symbol: SPATS2
• Gene ID (NCBI): 65244
• RRID: AB_3742640
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86XZ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPATS2, also known as SCR59 and SPATA10, is a member of the RNA-binding proteins whose aberrant expression is associated with carcinogenesis in several types of cancer. It is mainly expressed in the adult testis, with low expression in liver and other tissues (PMID: 33037180). The apparent molecular weight is higher than the calculated molecular weight of 60 kDa, probably due to post-translational modification, probably by phosphorylation.