SPATS2L Polyclonal antibody

• 

  WB analysis using 29930-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29930-1-AP (SPATS2L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29930-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29930-1-AP (SPATS2L antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 29930-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29930-1-AP (SPATS2L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 29930-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29930-1-AP (SPATS2L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 29930-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29930-1-AP (SPATS2L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 29930-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 29930-1-AP (SPATS2L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 29930-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SPATS2L antibody (29930-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 29930-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SPATS2L antibody (29930-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 29930-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SPATS2L antibody (29930-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

SPATS2L Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29930-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DKFZp564A2416, DNAPTP6, LOC26010, SPATS2 like protein, SPATS2L

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human lung cancer tissue, human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29930-1-AP targets SPATS2L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31157

  Product name: Recombinant human SPATS2L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 290-488 aa of BC018736

  Sequence: NYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEAEPLGKGNSRHEHRRQPHNGFRPKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRGSVGRVSQCNLCPTRIEVSTDAAVLSVPAVTLVA

• Full Name: viral DNA polymerase-transactivated protein 6
• Calculated Molecular Weight: 488 aa, 54 kDa
• Observed Molecular Weight: 54-65 kDa
• GenBank Accession Number: BC018736
• Gene Symbol: SPATS2L
• Gene ID (NCBI): 26010
• RRID: AB_2923620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NUQ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPATS2L encodes spermatogenesis associated and serine-rich 2-like protein, also named DNAPTP6 (DNA polymerase transactivated protein 6) in human (PMID:11230166). SPATS2L acts as an important regulator of β2-adrenergic receptor down-regulation (PubMed: 25562107). MiR-1269a down-regulates the expression of SPATS2L and LRP6, thereby inhibiting the proliferation of liver cancer cells (PMID: 28081866, PMID:35252180). SPATS2L has several isoforms by alternative splicing.