SPEF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPEF2 Polyclonal antibody, PBS Only (27989-1-PBS)

• 

  WB analysis using 27989-1-AP (same clone as 27989-1-PBS)

  Rat testis tissue lysates were subjected to SDS PAGE followed by western blot with 27989-1-AP (SPEF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27989-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat testis using 27989-1-AP (same clone as 27989-1-PBS)

  IP result of anti-SPEF2 (IP:27989-1-AP, 4ug; Detection:27989-1-AP 1:1000) with rat testis tissue lysate 1800 ug. This data was developed using the same antibody clone with 27989-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 27989-1-AP (same clone as 27989-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using SPEF2 antibody (27989-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27989-1-PBS in a different storage buffer formulation.

SPEF2 Polyclonal Antibody for WB, IF-P, IP, Indirect ELISA

Cat No. 27989-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IP, Indirect ELISA

Synonyms

KPL2, Protein KPL2, sperm flagellar 2, Sperm flagellar protein 2

---

Product Information

27989-1-PBS targets SPEF2 in WB, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27506

  Product name: Recombinant human SPEF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-316 aa of NM_024867

  Sequence: MALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDEYIKKIQKRLEEDAFAREQREKRRRKLLM

• Full Name: sperm flagellar 2
• Calculated Molecular Weight: 210 kDa
• Observed Molecular Weight: 210 kDa
• GenBank Accession Number: NM_024867
• Gene Symbol: SPEF2
• Gene ID (NCBI): 79925
• RRID: AB_3742269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C093
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sperm flagellar protein 2 (SPEF2) is also named KPL2. As a cilia-associated protein, SPEF2 is broadly expressed in various cilia-related organs, such as the lung, spleen, trachea, brain, and testis (PMID: 10100999). SPEF2 is known to be essential for sperm tail development (PMID: 28619825). During spermatogenesis, SPEF2 is weakly expressed in cytoplasm in pachytene spermatocytes and round spermatocytes, then SPEF2 is localized in the manchette of steps 10-12 elongating spermatids, in the basal body at steps 13-14, and finally in the midpiece of the sperm tail at steps 14-16 (PMID: 19889948). Spef2 is expressed in the bone and cartilage, and Spef2 expression in osteoblasts increases during in vitro differentiation (PMID: 29339787).