SPEG Polyclonal antibody

• 

SPEG Polyclonal Antibody for ELISA

Cat No. 15701-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

APEG 1, APEG1, BPEG, KIAA1297, SPEG, SPEG complex locus, SPEGalpha, SPEGbeta

---

Product Information

15701-1-AP targets SPEG in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8330

  Product name: Recombinant human SPEG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 851-964 aa of BC006346

  Sequence: MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE

• Full Name: SPEG complex locus
• Calculated Molecular Weight: 3223aa,349 kDa; 113aa,13 kDa
• GenBank Accession Number: BC006346
• Gene Symbol: SPEG
• Gene ID (NCBI): 10290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15772
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.