SPERT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPERT Polyclonal antibody, PBS Only (17826-1-PBS)

• 

  WB analysis of mouse testis using 17826-1-AP (same clone as 17826-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17826-1-AP (SPERT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17826-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 17826-1-AP (same clone as 17826-1-PBS)

  WB result of SPERT antibody (17826-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPERT transfected PC-3 cells. This data was developed using the same antibody clone with 17826-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 17826-1-AP (same clone as 17826-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 17826-1-AP (SPERT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17826-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spermatophore using 17826-1-AP (same clone as 17826-1-PBS)

  mouse spermatophore tissue were subjected to SDS PAGE followed by western blot with 17826-1-AP (SPERT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17826-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 17826-1-AP (same clone as 17826-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using SPERT antibody (17826-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17826-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SPERT Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17826-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17826-1-PBS targets SPERT in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12200

  Product name: Recombinant human SPERT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-412 aa of BC027609

  Sequence: MQPEGLKCRMEESNAERGTAEPFPRLHNLYSTPRCAQQAALPRLSRRMASQHSYPLNRFSSVPLDPMERPMSQADLELDYNPPRVQLSDEMFVFQDGRWVNENCRLQSPYFSPSASFHHKLHHKRLAKECMLQEENKSLREENKALREENRMLSKENKILQVFWEEHKASLGREESRAPSPLLHKDSASLEVVKKDHVALQVPRGKEDSTLQLLREENRALQQLLEQKQAYWAQAEDTAAPAEESKPAPSPHEEPCSPGLLQDQGSGLSSRFEEPKGPPARQEDSKELRALRKMVSNMSGPSGEEEAKVGPGLPDGCQPLQLLREMRQALQALLKENRLLQEENRTLQVLRAEHRGFQEENKALWENNKLKLQQKLVIDTVTEVTARMEMLIEELYAFMPARSQDPKKPSRV

• Full Name: spermatid associated
• Calculated Molecular Weight: 448 aa, 47 kDa, 52 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: BC027609
• Gene Symbol: SPERT
• Gene ID (NCBI): 220082
• RRID: AB_2195674
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NA61
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPERT (spermatid associated protein), also known as CBY2 (chibby homolog 2) or NURIT, is a novel leucine-zipper protein belonging to the chibby family of proteins [PMID:12204287]. Uniquely expressed in the spermatid flower-like structure, SPERT interacts with Nek1, a member of the NIMA-family kinase family that is associated centrosomal stability and ciliogenesis. It contains a leucine-zipper motif and two coiled-coil regions, and is transcribed through the elongation stage of the spermatids. SPERT is absent from mature spermatozoa and is thought to be involved in transporting proteins that are to be discarded via the residual bodies. [PMID:12204287]