SPG21 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPG21 Polyclonal antibody (19815-1-AP)

• 

  WB analysis using 19815-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19815-1-AP (SPG21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SPG21 Polyclonal Antibody for WB, ELISA

Cat No. 19815-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ABHD21, Acid cluster protein 33, ACP33, BM 019, GL010

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19815-1-AP targets SPG21 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13851

  Product name: Recombinant human SPG21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC000244

  Sequence: MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ

• Full Name: spastic paraplegia 21 (autosomal recessive, Mast syndrome)
• Calculated Molecular Weight: 308 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC000244
• Gene Symbol: SPG21
• Gene ID (NCBI): 51324
• RRID: AB_3741970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZD8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPG21, also known as Maspardin, is a protein encoded by the SPG21 gene on human chromosome 15q22.31. SPG21 is critical for the proper movement and positioning of lysosomes within neurons, which is essential for maintaining axonal health. Mutations in the SPG21 gene underlie hereditary spastic paraplegia (SPG) type 21 (also known as Mast syndrome). This is a complex form of SPG characterized by motor coordination defects due to axonal degeneration of corticospinal neurons and associated with dementia, cerebellar, and extrapyramidal abnormalities and, in some cases, seizures.(PMID: 41400694,PMID: 34492745)