SPIN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPIN1 Polyclonal antibody (12105-1-AP)

• Featured Product
• KD/KO Validated

SPIN1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 12105-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Spindlin1, spindlin 1, SPIN 1, SPIN, Ovarian cancer-related protein

• 

  WB analysis using 12105-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12105-1-AP (SPIN1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12105-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12105-1-AP (SPIN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 12105-1-AP

  WB result of SPIN1 antibody (12105-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPIN1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 12105-1-AP

  IP result of anti-SPIN1 (IP:12105-1-AP, 3ug; Detection:12105-1-AP 1:800) with HeLa cells lysate 1840ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 12105-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using SPIN1 antibody (12105-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPIN1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12105-1-AP targets SPIN1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2750

  Product name: Recombinant human SPIN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-262 aa of BC013571

  Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

• Full Name: spindlin 1
• Calculated Molecular Weight: 262 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC013571
• Gene Symbol: SPIN1
• Gene ID (NCBI): 10927
• RRID: AB_2196111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y657
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762)

Publications

What published studies show

The SPIN1 Polyclonal antibody (Cat# 12105-1-AP) has 16 citations. They appear in journals including Nature Communications, Nature Structural & Molecular Biology, Cell Death & Disease, EMBO Reports, Journal of Molecular Cell Biology, PLoS Pathogens, ACS Biomaterials Science & Engineering, Molecular Oncology, Journal of Molecular Biology, FEBS Letters, Life Science Alliance, Biochemical & Biophysical Research Communications, Bioengineered, eLife, and Biochemistry & Biophysics Reports. Research fields span epigenetics and histone methylation, rRNA transcription, tumorigenesis and cancer (lung, gastric, colorectal, osteosarcoma), antiviral defense, cell cycle, and oocyte development.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Structural mechanism of bivalent histone H3K4me3K9me3 recognition by the Spindlin1/C11orf84 complex in rRNA transcription activation.; Authors - Yongming Du ; KD Validated
human	WB	Cell Death Dis; SPIN1 accelerates tumorigenesis and confers radioresistance in non-small cell lung cancer by orchestrating the FOXO3a/FOXM1 axis; Authors - Min Zhong ; KD Validated
	WB,IF	Nat Struct Mol Biol; The subcortical maternal complex safeguards mouse oocyte-to-embryo transition by preventing nuclear entry of SPIN1; Authors - Chengpeng Xu
human	WB	EMBO Rep; SPIN1 facilitates chemoresistance and HR repair by promoting Tip60 binding to H3K9me3; Authors - Yukun Wang ; KD Validated
human	WB,IF	EMBO Rep; Nucleolar protein Spindlin1 recognizes H3K4 methylation and stimulates the expression of rRNA genes.; Authors - Wang Weixiang W ; KD Validated
human	WB	ACS Biomater Sci Eng; Soft Substrate Promotes Osteosarcoma Cell Self-Renewal, Differentiation, and Drug Resistance Through miR-29b and Its Target Protein Spin 1.; Authors - Shun Li