SPIN1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68615-1-Ig (same clone as 68615-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68615-1-Ig (SPIN1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68615-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68615-1-Ig (same clone as 68615-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68615-1-Ig (SPIN1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68615-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 68615-1-Ig (same clone as 68615-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 68615-1-Ig (SPIN1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68615-1-PBS in a different storage buffer formulation.

SPIN1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68615-1-PBS

Clone No.1G8C5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit

Applications

WB, Indirect ELISA

Synonyms

OCR, Ovarian cancer related protein, SPIN, SPIN1, spindlin 1

---

Product Information

68615-1-PBS targets SPIN1 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples.

• Tested Reactivity: Human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33686

  Product name: Recombinant human SPIN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-262 aa of BC013571

  Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

• Full Name: spindlin 1
• Calculated Molecular Weight: 262 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC013571
• Gene Symbol: SPIN1
• Gene ID (NCBI): 10927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y657
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762)