SPINK5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPINK5 Polyclonal antibody (29808-1-AP)

SPINK5 Polyclonal Antibody for WB, ELISA

Cat No. 29808-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

DKFZp686K19184, FLJ21544, FLJ97536, FLJ97596, FLJ99794, LEKTI, LETKI, NETS, NS, SPINK5, VAKTI

• 

  WB analysis of COLO 320 using 29808-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 29808-1-AP (SPINK5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPINK5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29808-1-AP targets SPINK5 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30432

  Product name: Recombinant human SPINK5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-200 aa of NM_001127698

  Sequence: KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL

• Full Name: serine peptidase inhibitor, Kazal type 5
• Calculated Molecular Weight: 121 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: NM_001127698
• Gene Symbol: SPINK5
• Gene ID (NCBI): 11005
• RRID: AB_3086168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ38
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SPINK5 Polyclonal antibody (Cat# 29808-1-AP) has 1 citation to date. It was cited in Frontiers in Immunology (2025), in a study on the clinical and immunological characterization of a Netherton syndrome infant with a SPINK gene cluster deletion and a SPINK5 polymorphism. The associated research field is immunology and genetic dermatology, specifically focusing on Netherton syndrome and SPINK5-related pathogenic variants.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Front Immunol; Clinical and immunological characterization of a Netherton syndrome infant with a large SPINK gene cluster deletion and a c.1258A>G polymorphism in SPINK5; Authors - Yaning Guan