SPINK5L3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPINK5L3 Polyclonal antibody (24656-1-AP)

• 

  IHC staining of rat testis using 24656-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 24656-1-AP (SPINK5L3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24656-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24656-1-AP (SPINK5L3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SPINK5L3 Polyclonal Antibody for IHC, ELISA

Cat No. 24656-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

HBVDNAPTP1, HESPINTOR, serine PI Kazal type 5 like 3, SPINK13

---

Tested Applications

• Positive IHC detected in: rat testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24656-1-AP targets SPINK5L3 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19715

  Product name: Recombinant human SPINK5L3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-94 aa of BC128164

  Sequence: KMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKCD

• Full Name: serine PI Kazal type 5-like 3
• Calculated Molecular Weight: 94 aa, 11 kDa
• GenBank Accession Number: BC128164
• Gene Symbol: SPINK5L3
• Gene ID (NCBI): 153218
• RRID: AB_3742120
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q1W4C9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPINK5L3 (Serine protease inhibitor Kazal-type 13) may be a serine protease inhibitor. It enables serine-type endopeptidase inhibitor activity, which is involved in the negative regulation of the acrosome reaction.