Home
Products
Primary Antibodies
SPINK9 Polyclonal antibody, PBS Only (24661-1-PBS)

Filter: AllIHC

IHC staining of human skin using 24661-1-AP (same clone as 24661-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24661-1-AP (SPINK9 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24661-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 24661-1-AP (same clone as 24661-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24661-1-AP (SPINK9 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24661-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 24661-1-AP (same clone as 24661-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24661-1-AP (SPINK9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24661-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 24661-1-AP (same clone as 24661-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 24661-1-AP (SPINK9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24661-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 24661-1-AP (same clone as 24661-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24661-1-AP (SPINK9 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24661-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 24661-1-AP (same clone as 24661-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24661-1-AP (SPINK9 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24661-1-PBS in a different storage buffer formulation.

SPINK9 Polyclonal antibody, PBS Only

Name: SPINK9 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24661-1-PBS

SPINK9 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24661-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24661-1-PBS targets SPINK9 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19924 Product name: Recombinant human SPINK9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 19-86 aa of BC137530 Sequence: SIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC Predict reactive species
Full Name	serine peptidase inhibitor, Kazal type 9
Calculated Molecular Weight	86 aa, 9 kDa
GenBank Accession Number	BC137530
Gene Symbol	SPINK9
Gene ID (NCBI)	643394
RRID	AB_2879661
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q5DT21
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.