SPINLW1 Polyclonal antibody

• 

SPINLW1 Polyclonal Antibody for ELISA

Cat No. 14378-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

Cancer/testis antigen 71, CT71, Epididymal protease inhibitor, EPPIN, EPPIN1, EPPIN2, EPPIN3, Protease inhibitor WAP7, SPINLW1, WAP7, WFDC7

---

Product Information

14378-1-AP targets SPINLW1 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5757

  Product name: Recombinant human SPINLW1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC053369

  Sequence: MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP

• Full Name: serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin)
• Calculated Molecular Weight: 15 kDa
• GenBank Accession Number: BC053369
• Gene Symbol: SPINLW1
• Gene ID (NCBI): 57119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95925
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.