SPINT2 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP02034-3

  Sandwich ELISA standard curve of MP02034-3, Human SPINT2/HAI-2 Recombinant Matched Antibody Pair - PBS only. 85684-5-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3130. 85684-3-PBS was HRP conjugated as the detection antibody. Range: 0.391-25 ng/mL.

• 

  Sample test of MP02034-3

  The mean SPINT2/HAI-2 concentration was determined to be 38.76 ng/mL in MCF-7 cell extract based on a 1.30 mg/mL extract load and 46.55 ng/mL in Caco-2 cell extract based on a 2.00 mg/mL extract load.

SPINT2 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85684-3-PBS

Clone No.243094B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

HAI2, HAI-2, Kop, Kunitz-type protease inhibitor 2, SPINT 2

---

Product Information

85684-3-PBS targets SPINT2 as part of a matched antibody pair:

MP02034-3: 85684-5-PBS capture and 85684-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3130

  Product name: Recombinant Human SPINT2/HAI-2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-197 aa of NM_021102.3

  Sequence: ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

• Full Name: serine peptidase inhibitor, Kunitz type, 2
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: NM_021102.3
• Gene Symbol: SPINT2
• Gene ID (NCBI): 10653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43291-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.