SPINT2/HAI-2 Recombinant monoclonal antibody

• 

  WB analysis using 85684-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85684-6-RR (SPINT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 85684-6-RR

  WB result of SPINT2/HAI-2 antibody (85684-6-RR; 1:2400; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPINT2/HAI-2 transfected MCF-7 cells.

• 

  Affinity of 85684-6-RR

  Biolayer interferometry (BLl) kinetic assays of 85684-6-RR against Human SPINT2/HAI-2 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

SPINT2/HAI-2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85684-6-RR

Clone No.243094E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

SPINT2, HAI2, HAI-2, Kop, Kunitz-type protease inhibitor 2

---

Tested Applications

• Positive WB detected in: MCF-7 cells, Caco-2 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85684-6-RR targets SPINT2/HAI-2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3130

  Product name: Recombinant Human SPINT2/HAI-2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 28-197 aa of NM_021102.3

  Sequence: ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK

• Full Name: serine peptidase inhibitor, Kunitz type, 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-34 kDa
• GenBank Accession Number: NM_021102.3
• Gene Symbol: SPINT2
• Gene ID (NCBI): 10653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43291-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serine peptidase inhibitor Kunitz type 2 (SPINT2) is a serine protease inhibitor Kunitz type 2, also known as hepatocyte growth factor (HGF) activator (HGFA) inhibitor type 2 (HAI-2). It displays inhibitory activity in membrane serine proteases, such as matriptase and hepsin, as well as secreted proteases such as HGFA and plasmin (PMID: 9771903, PMID: 15792801). SPINT2 is a tumor suppressor gene that inhibits proteases implicated in cancer progression, like HGFA, hepsin and matriptase (PMID: 30168196). SPINT2 regulates cell proliferation, migration and invasion via a reduction in HGFA, leading to apoptosis and necrosis of uterine leiomyosarcoma cells (PMID: 20664929). This target may exhibit a molecular weight of approximately 28-34 kDa due to glycosylation modification.