PBK/SPK Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 84970-1-RR (same clone as 84970-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84970-1-RR (PBK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84970-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP01693-1

  Sandwich ELISA standard curve of MP01693-1, Human PBK Recombinant Matched Antibody Pair - PBS only. 84970-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag9033. 84970-4-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

• 

  Sample test of MP01693-1

  The mean PBK concentration was determined to be 342.86 ng/mL in HeLa cell extract based on a 1.30 mg/mL extract load and 1,243.51 ng/mL in Jurkat cell extract based on a 2.00 mg/mL extract load.

• 

  IF Staining of HeLa using 84970-1-RR (same clone as 84970-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PBK/SPK antibody (84970-1-RR, Clone: 242545A11 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84970-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84970-1-RR (same clone as 84970-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug PBK/SPK Recombinant antibody (84970-1-RR, Clone:242545A11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 84970-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01693-1

  Cytometric bead array standard curve of MP01693-1, PBK Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84970-1-PBS. Detection antibody: 84970-4-PBS. Standard: Ag9033. Range: 0.781-100 ng/mL.

PBK/SPK Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84970-1-PBS

Clone No.242545A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

PBK, 242545A11, Cancer/testis antigen 84, CT84, EC:2.7.12.2

---

Product Information

84970-1-PBS targets PBK/SPK as part of a matched antibody pair:

MP01693-1: 84970-1-PBS capture and 84970-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9033

  Product name: Recombinant human SPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-322 aa of BC015191

  Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

• Full Name: PDZ binding kinase
• Calculated Molecular Weight: 322 aa, 36 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC015191
• Gene Symbol: PBK
• Gene ID (NCBI): 55872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96KB5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PBK(PDZ-binding kinase) is also named as TOPK, CT84, Nori-3, SPK and belongs to the MAP kinase kinase subfamily. PBK may have a role in the regulation of cellular proliferation and progression of the cell cycle. It has a characteristic cdc2ycyclin B phosphorylation site(SyT-P-X-KyR) at its N terminus,which is conserved across species, and it is phosphorylated in a cell cycle-dependent manner at mitosis, and that this phosphorylation is required for its activation(PMID:10779557).