PBK/SPK Recombinant monoclonal antibody, PBS Only (Capture)

PBK/SPK Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84970-1-PBS
Clone No.242545A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

PBK, 242545A11, Cancer/testis antigen 84, CT84, EC:2.7.12.2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84970-1-PBS targets PBK/SPK as part of a matched antibody pair:

MP01693-1: 84970-1-PBS capture and 84970-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9033

Product name: Recombinant human SPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC015191

Sequence: MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

Predict reactive species
Full Name PDZ binding kinase
Calculated Molecular Weight 322 aa, 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC015191
Gene Symbol PBK
Gene ID (NCBI) 55872
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96KB5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PBK(PDZ-binding kinase) is also named as TOPK, CT84, Nori-3, SPK and belongs to the MAP kinase kinase subfamily. PBK may have a role in the regulation of cellular proliferation and progression of the cell cycle. It has a characteristic cdc2ycyclin B phosphorylation site(SyT-P-X-KyR) at its N terminus,which is conserved across species, and it is phosphorylated in a cell cycle-dependent manner at mitosis, and that this phosphorylation is required for its activation(PMID:10779557).

Loading...
||
New chat Able
正在加载,请稍候...