SPOCK1 Polyclonal antibody

• 

  WB analysis using 28203-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28203-1-AP (SPOCK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 28203-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28203-1-AP (SPOCK1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 28203-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 28203-1-AP (SPOCK1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 28203-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 28203-1-AP (SPOCK1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SPOCK1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28203-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Protein SPOCK, SPOCK, TESTICAN, Testican 1, Testican-1

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells, DU 145 cells, mouse brain tissue, mouse stomach tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

28203-1-AP targets SPOCK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28213

  Product name: Recombinant human SPOCK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 97-236 aa of BC030691

  Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR

• Full Name: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1
• Calculated Molecular Weight: 439 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC030691
• Gene Symbol: SPOCK1
• Gene ID (NCBI): 6695
• RRID: AB_3086036
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08629
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Heliyon; Extrachromosomal circular DNA-related SPOCK1 contributes to development and enzalutamide resistance of prostate cancer by regulating epithelial mesenchymal transition; Authors - Yicong Yao
human	IHC	Int Immunopharmacol; Shared chemoresistance genes in ESCC and cervical Cancer: Insights from pharmacogenomics and Mendelian randomization; Authors - Ziyu Liu