SPON2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPON2 Polyclonal antibody (20513-1-AP)

• Featured Product
• KD/KO Validated

SPON2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20513-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

DIL 1, DIL1, M spondin, Mindin, SPON2, Spondin 2

• 

  WB analysis of LNCaP using 20513-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 20513-1-AP (SPON2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20513-1-AP (SPON2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20513-1-AP (SPON2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate hyperplasia using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 20513-1-AP (SPON2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate hyperplasia using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia using 20513-1-AP (SPON2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 20513-1-AP (SPON2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 20513-1-AP (SPON2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 20513-1-AP (SPON2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 20513-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 20513-1-AP (SPON2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPON2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells
• Positive IHC detected in: human prostate cancer tissue, human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20513-1-AP targets SPON2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14337

  Product name: Recombinant human SPON2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-221 aa of BC002707

  Sequence: ESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHP

• Full Name: spondin 2, extracellular matrix protein
• Calculated Molecular Weight: 331 aa, 36 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC002707
• Gene Symbol: SPON2
• Gene ID (NCBI): 10417
• RRID: AB_2878696
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUD6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPON2 (Spondin 2), also known as Mindin, is a member of the F-spondin family of secreted extracellular matrix proteins. This protein has been implicated in axon guidance, immune response and adhesion. SPON2 is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens (PMID: 14691481). It also functions as an integrin ligand for inflammatory cell recruitment and T-cell priming (PMID: 19153605). Besides, SPON2 has been reported as a prognostic biomarker for ovarian and prostate cancer (PMID: 17490732; 22615945; 23665271).

Publications

What published studies show

The Spondin 2 (SPON2) antibody (Cat# 20513-1-AP) has 11 citations across journals including Nature, Cancer Research, International Journal of Biological Macromolecules, Frontiers in Cell and Developmental Biology, Journal of Cellular and Molecular Medicine, Translational Lung Cancer Research, Frontiers in Oncology, Immunological Research, Clinical Breast Cancer, and Journal of Natural Medicine. Research fields span hepatocellular carcinoma, prostate cancer, recurrent pregnancy loss, glioma, gastric cancer, lung adenocarcinoma, breast cancer, allergic asthma, and macrophage-mediated inflammation.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Nature; Spatial immune scoring system predicts hepatocellular carcinoma recurrence; Authors - Gengjie Jia
human	IHC	Cancer Res; Combining Spatial Transcriptomics, Pseudotime, and Machine Learning Enables Discovery of Biomarkers for Prostate Cancer; Authors - Martin Smelik
human	IF	Int J Biol Macromol; Downregulation of the biological macromolecule Spondin-2 disrupts maternal-fetal immune tolerance and trophoblast invasion, driving unexplained recurrent pregnancy loss.; Authors - Xue Zhang
human,mouse	WB,IF	Front Cell Dev Biol; Transcriptional Activation of Matricellular Protein Spondin2 (SPON2) by BRG1 in Vascular Endothelial Cells Promotes Macrophage Chemotaxis.; Authors - Nan Li
human	IHC	Front Cell Dev Biol; Integrative Analysis of DNA Methylation and Transcriptome Identifies a Predictive Epigenetic Signature Associated With Immune Infiltration in Gliomas.; Authors - Jianlei Zhang
human	WB	J Cell Mol Med; Spondin 2 promotes the proliferation, migration and invasion of gastric cancer cells.; Authors - Haoming Lu ; KD Validated