Home
Products
Primary Antibodies
SPPL2A Polyclonal antibody, PBS Only (13255-1-PBS)

Filter: AllWBIHC

WB analysis of human colon using 13255-1-AP (same clone as 13255-1-PBS)
human colon tissue were subjected to SDS PAGE followed by western blot with 13255-1-AP (SPPL2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
WB analysis of mouse colon using 13255-1-AP (same clone as 13255-1-PBS)
mouse colon tissue were subjected to SDS PAGE followed by western blot with 13255-1-AP (SPPL2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 13255-1-AP (same clone as 13255-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 13255-1-AP (SPPL2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 13255-1-AP (same clone as 13255-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 13255-1-AP (SPPL2A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
WB analysis of human colon using 13255-1-AP (same clone as 13255-1-PBS)
human colon tissue were subjected to SDS PAGE followed by western blot with 13255-1-AP (SPPL2A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 13255-1-AP (same clone as 13255-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 13255-1-AP (SPPL2A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 13255-1-AP (same clone as 13255-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 13255-1-AP (SPPL2A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 13255-1-AP (same clone as 13255-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 13255-1-AP (SPPL2A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 13255-1-AP (same clone as 13255-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 13255-1-AP (SPPL2A antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 13255-1-AP (same clone as 13255-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 13255-1-AP (SPPL2A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 13255-1-AP (same clone as 13255-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 13255-1-AP (SPPL2A antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13255-1-PBS in a different storage buffer formulation.

SPPL2A Polyclonal antibody, PBS Only

Name: SPPL2A Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 13255-1-PBS

SPPL2A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13255-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

13255-1-PBS targets SPPL2A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3935 Product name: Recombinant human SPPL2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 361-520 aa of BC025740 Sequence: ITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ Predict reactive species
Full Name	signal peptide peptidase-like 2A
Calculated Molecular Weight	520 aa, 58 kDa
Observed Molecular Weight	58 kDa
GenBank Accession Number	BC025740
Gene Symbol	SPPL2A
Gene ID (NCBI)	84888
RRID	AB_2195000
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8TCT8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SPPL2A(Signal peptide peptidase-like 2A) is also named as IMP3(Intramembrane protease 3), PSL2(Presenilin-like protein 2) and belongs to the peptidase A22B family. It is an aspartyl intramembrane protease, has been implicated in the proteolysis of TNF-alpha, Fas Ligand and Bri2 and endogenous signal-peptide-peptidase-like2A (SPPL2a) is localised in lysosomes/late endosomes(PMID:21896273). This protein has a signal peptide with 25 amino acid and seven glycosylation sites.