SPR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPR Polyclonal antibody (16822-1-AP)

SPR Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16822-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:1.1.1.153, SDR38C1, Sepiapterin reductase

• 

  WB analysis using 16822-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16822-1-AP (SPR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 16822-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 16822-1-AP (SPR Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 16822-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 16822-1-AP (SPR Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 16822-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16822-1-AP (SPR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16822-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16822-1-AP (SPR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 16822-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16822-1-AP (SPR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 16822-1-AP

  IP result of anti-SPR (IP:16822-1-AP, 4ug; Detection:16822-1-AP 1:500) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16822-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16822-1-AP (SPR Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16822-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16822-1-AP (SPR Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 16822-1-AP

  Immunofluorescent analysis of Hela cells, using SPR antibody 16822-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, rat heart tissue, rat liver tissue, human liver tissue, K-562 cells
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16822-1-AP targets SPR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10395

  Product name: Recombinant human SPR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC017310

  Sequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK

• Full Name: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
• Calculated Molecular Weight: 261 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC017310
• Gene Symbol: SPR
• Gene ID (NCBI): 6697
• RRID: AB_2286632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35270
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Metabolic determinants of cancer cell sensitivity to canonical ferroptosis inducers.; Authors - Mariluz Soula
mouse	WB	Acta Physiol (Oxf); Tetrahydrobiopterin synthesis and metabolism is impaired in dystrophin-deficient mdx mice and humans.; Authors - Angus Lindsay
human	WB	Phytomedicine; Cimifugin suppresses type 2 airway inflammation by binding to SPR and regulating its protein expression in a non-enzymatic manner; Authors - Xiaoqun Gu
	WB	Cell Death Dis; Identification of genes supporting cold resistance of mammalian cells: lessons from a hibernator; Authors - Masamitsu Sone