SPRR2A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPRR2A Polyclonal antibody (26135-1-AP)

• 

  IHC staining of human colon cancer using 26135-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26135-1-AP (SPRR2A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SPRR2A Polyclonal Antibody for IHC, ELISA

Cat No. 26135-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

SPR 2A, SPR2A

---

Tested Applications

• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26135-1-AP targets SPRR2A in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23537

  Product name: Recombinant human SPRR2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC096108

  Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

• Full Name: small proline-rich protein 2A
• GenBank Accession Number: BC096108
• Gene Symbol: SPRR2A
• Gene ID (NCBI): 6700
• RRID: AB_3742170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35326
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.