SPRR2D Polyclonal antibody

• 

  IHC staining of human oesophagus using 23046-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 23046-1-AP (SPRR2D Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 23046-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 23046-1-AP (SPRR2D Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human oesophagus using 23046-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 23046-1-AP (SPRR2D Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 23046-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 23046-1-AP (SPRR2D Antibody) at dilution of 1:50 (under 10x lens).

SPRR2D Polyclonal Antibody for IHC, ELISA

Cat No. 23046-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, IF, ELISA

Synonyms

small proline rich protein 2D, Small proline rich protein II, SPR 2D, SPR II, SPRR2D

---

Tested Applications

• Positive IHC detected in: human oesophagus tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

23046-1-AP targets SPRR2D in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19079

  Product name: Recombinant human SPRR2D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-54 aa of BC120938

  Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKY

• Full Name: small proline-rich protein 2D
• Calculated Molecular Weight: 72 aa, 8 kDa
• GenBank Accession Number: BC120938
• Gene Symbol: SPRR2D
• Gene ID (NCBI): 6703
• RRID: AB_2879202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P22532
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Theranostics; Cdc42 Deficiency Leads To Epidermal Barrier Dysfunction by Regulating Intercellular Junctions and Keratinization of Epidermal Cells during Mouse Skin Development.; Authors - Min Zhang
mouse	IHC	Ecotoxicol Environ Saf; Antiestrogenic property of 9,9-bis[4-(2-hydroxyethoxy)phenyl]fluorene (BPEF) and its effects on female development in CD-1 mice; Authors - Xiaojing Jia
mouse	IHC	Ecotoxicol Environ Saf; 4,4'-(9-Fluorenylidene)dianiline (BAFL) is antiestrogenic and has adverse effects on female development in CD-1 mice; Authors - Xiaojing Jia
mouse	IF	bioRxiv; Hair follicles modulate skin barrier function; Authors - Noah C Ford
		Cell Rep; Hair follicles modulate skin barrier function; Authors - Noah C Ford