SPRY3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPRY3 Polyclonal antibody, PBS Only (17932-1-PBS)

• 

  WB analysis of RAW264.7 using 17932-1-AP (same clone as 17932-1-PBS)

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 17932-1-AP (SPRY3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17932-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 17932-1-AP (same clone as 17932-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17932-1-AP (SPRY3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17932-1-PBS in a different storage buffer formulation.

SPRY3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17932-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

HSPRY3, Protein sprouty homolog 3, sprouty homolog 3 (Drosophila), Sprouty RTK signaling antagonist 3, Sprouty3

---

Product Information

17932-1-PBS targets SPRY3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12364

  Product name: Recombinant human SPRY3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-218 aa of BC074973

  Sequence: MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSC

• Full Name: sprouty homolog 3 (Drosophila)
• Calculated Molecular Weight: 288 aa, 31 kDa
• Observed Molecular Weight: 31-33 kDa
• GenBank Accession Number: BC074973
• Gene Symbol: SPRY3
• Gene ID (NCBI): 10251
• RRID: AB_2195432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43610
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.