Tested Applications
| Positive WB detected in | A375 cells, HepG2 cells |
| Positive IHC detected in | mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22765-1-AP targets SPRY4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18574 Product name: Recombinant human SPRY4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC125095 Sequence: MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKC Predict reactive species |
| Full Name | sprouty homolog 4 (Drosophila) |
| Calculated Molecular Weight | 299 aa, 33 kDa |
| Observed Molecular Weight | 35-38 kDa |
| GenBank Accession Number | BC125095 |
| Gene Symbol | SPRY4 |
| Gene ID (NCBI) | 81848 |
| RRID | AB_2879163 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9C004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPRY4, also named as Protein sprouty homolog 4, is a 299 amino acid protein, which contains one SPR (sprouty) domain and belongs to the sprouty family. SPRY4 Suppresses the INS receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras. SPRY4 has a cellular function to regulate the actin cytoskeleton, independent of its inhibitory activity on the Ras/MAP kinase signalling. SPRY1, SPRY2, SPRY3, SPRY4, are central and complex regulators of the receptor tyrosine kinase (RTK) signalling pathway.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SPRY4 antibody 22765-1-AP | Download protocol |
| IHC protocol for SPRY4 antibody 22765-1-AP | Download protocol |
| WB protocol for SPRY4 antibody 22765-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-SPRY4 (Cat# 22765-1-AP) has 8 total citations across journals including Nature Communications, Molecular Cell, Journal of Clinical Investigation, Cell Death & Disease, Cancer Letters, International Journal of Biological Macromolecules, Adipocyte, and American Journal of Reproductive Immunology. Research fields span oncology (pancreatic, ovarian, hepatic, and thyroid cancers), drug resistance mechanisms, bone development/scoliosis, adipogenic differentiation, and reproductive immunology (recurrent miscarriage). Applications include WB, IHC, and IF in human samples.
| Species | Application | Title |
|---|---|---|
Nat Commun AXL confers intrinsic resistance to osimertinib and advances the emergence of tolerant cells.
| ||
Mol Cell HDAC5 depletion promotes hyper-acetylation of FOXA1 and potentiates HIF1α transcriptional activation in pancreatic cancer. | ||
J Clin Invest Targeting enhancer reprogramming to mitigate MEK inhibitor resistance in preclinical models of advanced ovarian cancer.
| ||
Cell Death Dis SPRY4 is responsible for pathogenesis of adolescent idiopathic scoliosis by contributing to osteogenic differentiation and melatonin response of bone marrow-derived mesenchymal stem cells.
| ||
Cancer Lett Coupling HDAC4 with transcriptional factor MEF2D abrogates SPRY4-mediated suppression of ERK activation and elicits hepatocellular carcinoma drug resistance.
| ||
Int J Biol Macromol CircPFKP orchestrates a novel competing endogenous RNA network to regulate SPRY4/p38-MAPK signaling and modulate papillary thyroid carcinoma aggressiveness.
|
