SPSB2 Polyclonal antibody

• 

SPSB2 Polyclonal Antibody for ELISA

Cat No. 20377-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

Gene rich cluster protein C9, GRCC9, SPSB2, SSB 2, SSB2

---

Product Information

20377-1-AP targets SPSB2 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13991

  Product name: Recombinant human SPSB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-263 aa of BC002983

  Sequence: ALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ

• Full Name: splA/ryanodine receptor domain and SOCS box containing 2
• Calculated Molecular Weight: 263 aa, 29 kDa
• GenBank Accession Number: BC002983
• Gene Symbol: SPSB2
• Gene ID (NCBI): 84727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99619
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.