SPTAN1 Polyclonal antibody

• 

  WB analysis of HeLa using 31676-1-AP

  WB result of SPTAN1 antibody (31676-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPTAN1 transfected HeLa cells.

• 

  WB analysis using 31676-1-AP

  Various lysates were subjected to SDS-PAGE followed by western blot with 31676-1-AP (SPTAN1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31676-1-AP

  Various lysates were subjected to SDS-PAGE followed by western blot with 31676-1-AP (SPTAN1 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 31676-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 31676-1-AP (SPTAN1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 31676-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 31676-1-AP (SPTAN1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 31676-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 31676-1-AP (SPTAN1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31676-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SPTAN1 antibody (31676-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

SPTAN1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31676-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Alpha II spectrin, NEAS, SPTA2

---

Tested Applications

• Positive WB detected in: HT-29 cells, HeLa cells, mouse brain tissue, MDA-MB-231 cells, rat brain tissue
• Positive IHC detected in: human stomach cancer tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31676-1-AP targets SPTAN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36472

  Product name: Recombinant human SPTAN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2315-2472 aa of NM_003127.3

  Sequence: RNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN

• Full Name: spectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
• Calculated Molecular Weight: 285kDa，2472aa
• Observed Molecular Weight: 285 kDa,150 kDa
• GenBank Accession Number: NM_003127.3
• Gene Symbol: SPTAN1
• Gene ID (NCBI): 6709
• RRID: AB_3670071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q13813
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTAN1 (Nonerythroid spectrin αII), also termed α-Fodrin, is a cytoskeletal protein that belongs to the family of spectrins. Spectrins includes several structural proteins (α- and β-spectrin, α-actinin, dystrophin, and utrophin) that build and stabilize the cytoskeleton by forming a hexagonal mesh under the plasma membrane and ensuring stability and organization of organelles in the cell. SPTAN1 encodes for a 2,472 amino acid protein with a predicted molecular weight of 284 kDa and can be cleaved by calpain leading to a 150 kDa fragment (PMID: 31186638).