SPTBN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SPTBN1 Polyclonal antibody (25681-1-AP)

• Featured Product
• KD/KO Validated

SPTBN1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25681-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Beta II spectrin, Beta-II spectrin, Spectrin beta chain, non-erythrocytic 1, Spectrin, non-erythroid beta chain 1

• 

  WB analysis of HEK-293 using 25681-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25681-1-AP (SPTBN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25681-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25681-1-AP (SPTBN1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 25681-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25681-1-AP (SPTBN1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 25681-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 25681-1-AP (SPTBN1 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 25681-1-AP

  Immunofluorescent analysis of HEK-293 cells using 25681-1-AP (SPTBN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SPTBN1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Caco-2 cells, mouse heart tissue, HEK-293 cells, SH-SY5Y cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25681-1-AP targets SPTBN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22459

  Product name: Recombinant human SPTBN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 633-820 aa of BC137282

  Sequence: EMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKE

• Full Name: spectrin, beta, non-erythrocytic 1
• Calculated Molecular Weight: 2364 aa, 275 kDa
• Observed Molecular Weight: 275 kDa
• GenBank Accession Number: BC137282
• Gene Symbol: SPTBN1
• Gene ID (NCBI): 6711
• RRID: AB_2880191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01082
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTBN1 is the non-erythrocytic form of β-spectrin or β-fodrin. Spectrins are members of the superfamily of F-actin cross linking proteins that are important as scaffolding proteins for protein sorting, cell adhesion, and migration. Reduced expression of SPTBN1 has been found to correlate with shorter survival of patients with hepatocellular cancer, pancreatic cancer and other malignancies of the gastrointestinal tract, suggesting tumor suppression ability of this protein.

Publications

What published studies show

The SPTBN1 Polyclonal antibody (Cat# 25681-1-AP) has 1 total citation. It was cited in Communications Biology (IF 5.8), in a 2025 study investigating how IGF2BP3 recruits NUDT21 to regulate SPTBN1 alternative polyadenylation, driving ovarian cancer progression. The associated research field is cancer biology, specifically ovarian cancer and post-transcriptional gene regulation. The application used was Western Blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; IGF2BP3 recruits NUDT21 to regulate SPTBN1 alternative polyadenylation and drive ovarian cancer progression; Authors - Xin Luo ; KD Validated