SPTBN4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SPTBN4 Recombinant monoclonal antibody (87776-1-RR)

• 

  WB analysis using 87776-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87776-1-RR (SPTBN4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SPTBN4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87776-1-RR

Clone No.253298C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Beta IV spectrin, KIAA1642, SPTBN3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87776-1-RR targets SPTBN4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36430

  Product name: Recombinant human SPTBN4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2100-2300 aa of NM_020971

  Sequence: WEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPATPAAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHSLTLGRYEQMERRRERRERRL

• Full Name: spectrin, beta, non-erythrocytic 4
• Calculated Molecular Weight: 288kDa
• Observed Molecular Weight: 288 kDa
• GenBank Accession Number: NM_020971
• Gene Symbol: SPTBN4
• Gene ID (NCBI): 57731
• RRID: AB_3745748
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H254
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTBN4 also known as beta-IV spectrin, encodes a nonerythrocytic member of the beta-spectrin protein family that is expressed in the brain, peripheral nervous system, pancreas, and skeletal muscle. Spectrins are rod-shaped proteins that were originally identified as part of the lattice-like cytoskeleton under the erythrocyte membrane(PMID: 11086001).