• Featured Product
  • KD/KO Validated

SPTLC1 Polyclonal antibody

SPTLC1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 15376-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

EC:2.3.1.50, HSAN1, LCB 1, LCB1, Serine-palmitoyl-CoA transferase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, human liver tissue, HeLa cells, HepG2 cells, L02 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15376-1-AP targets SPTLC1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1162

Product name: Recombinant human SPTLC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-143 aa of BC007085

Sequence: MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE

Predict reactive species
Full Name serine palmitoyltransferase, long chain base subunit 1
Calculated Molecular Weight 53 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC007085
Gene Symbol SPTLC1
Gene ID (NCBI) 10558
RRIDAB_2286678
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15269
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTLC1 is a subunit of serine palmitoyltransferase (SPT) which is the key enzyme in sphingolipid biosynthesis and is essential for embryogenesis and cell survival. Mutations in the SPTLC1 gene (C133W, C133Y, V144D, and G387A) were reported to be responsible for the development of an inherited sensory neuropathy (hereditary sensory neuropathy type I, HSN1).

Protocols

Product Specific Protocols
IHC protocol for SPTLC1 antibody 15376-1-APDownload protocol
IP protocol for SPTLC1 antibody 15376-1-APDownload protocol
WB protocol for SPTLC1 antibody 15376-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratIHC

Cell Metab

Central Ceramide Signaling Mediates Obesity-Induced Precocious Puberty.

Authors - Violeta Heras
humanWB

Sci Adv

Inhibition of sphingolipid de novo synthesis counteracts muscular dystrophy.

Authors - Pirkka-Pekka Laurila
mouseWB

J Neurosci

MicroRNA-137/181c regulates serine palmitoyltransferase and in turn amyloid β, novel targets in sporadic Alzheimer's disease.

Authors - Hirosha Geekiyanage
mouseWB,IHC

Neurobiol Aging

Inhibition of serine palmitoyltransferase reduces Aβ and tau hyperphosphorylation in a murine model: a safe therapeutic strategy for Alzheimer's disease.

Authors - Hirosha Geekiyanage
mouseWB

Am J Physiol Lung Cell Mol Physiol

Neutrophil elastase increases airway ceramide levels via upregulation of serine palmitoyltransferase.

Authors - Sophia Karandashova
humanWB

Front Cell Neurosci

Activation of Mitochondrial Unfolded Protein Response in SHSY5Y Expressing APP Cells and APP/PS1 Mice.

Authors - Yang Shen
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...