SPTLC1 Recombinant monoclonal antibody

• 

  WB analysis using 87141-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87141-1-RR (SPTLC1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87141-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87141-1-RR against Human SPTLC1 were performed. The affinity constant is 0.487 nM.

SPTLC1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87141-1-RR

Clone No.252268G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.3.1.50, HSAN1, LCB 1, LCB1, Serine-palmitoyl-CoA transferase 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87141-1-RR targets SPTLC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1162

  Product name: Recombinant human SPTLC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-143 aa of BC007085

  Sequence: MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE

• Full Name: serine palmitoyltransferase, long chain base subunit 1
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC007085
• Gene Symbol: SPTLC1
• Gene ID (NCBI): 10558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15269
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPTLC1 is a subunit of serine palmitoyltransferase (SPT) which is the key enzyme in sphingolipid biosynthesis and is essential for embryogenesis and cell survival. Mutations in the SPTLC1 gene (C133W, C133Y, V144D, and G387A) were reported to be responsible for the development of an inherited sensory neuropathy (hereditary sensory neuropathy type I, HSN1) (PMID: 39959268). Pathogenic variants in SPTLC1 are causative for hereditary sensory and autonomic neuropathy, juvenile amyotrophic lateral sclerosis, macular telangiectasia type 2, or Charcot-Marie-Tooth disease (PMID: 31751474). Western blot analysis detected a specific band at ~53 kDa (PMID: 36197001).