Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SQLE Monoclonal antibody, PBS Only (Capture)

SQLE Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67206-1-PBS
Clone No.1C9A2

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, pig

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

1C9A2, EC:1.14.14.17, ERG1, squalene epoxidase, Squalene monooxygenase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67206-1-PBS targets SQLE as part of a matched antibody pair:

MP50872-2: 67206-1-PBS capture and 67206-3-PBS detection (validated in Cytometric bead array)

MP50872-3: 67206-1-PBS capture and 67206-4-PBS detection (validated in Cytometric bead array)

MP50872-4: 67206-1-PBS capture and 67206-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3266

Product name: Recombinant human SQLE protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 143-508 aa of BC017033

Sequence: SRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKVSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGGMTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGECVAGPVGL

Predict reactive species
Full Name squalene epoxidase
Calculated Molecular Weight 574 aa, 64 kDa
Observed Molecular Weight 50-64 kDa
GenBank Accession NumberBC017033
Gene Symbol SQLE
Gene ID (NCBI) 6713
RRIDAB_2882499
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14534
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SQLE, also named as ERG1, SE and SM, belongs to the squalene monooxygenase family. It catalyzes the first oxygenation step in cholesterol synthesis, acting on squalene before cyclization into the basic steroid structure. SQLE may serve as a flux-controlling enzyme beyond 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR, considered as rate limiting). It is also posttranslationally regulated by cholesterol-dependent proteasomal degradation. SQLE is subject to feedback regulation via cholesterol-induced degradation, which depends on its lipid-sensing N terminal regulatory domain. Truncation of SQLE occurs during its endoplasmic reticulum-associated degradation and requires the proteasome, which partially degrades the SQLE N-terminus and eliminates cholesterol-sensing elements within this region. The MW of SQLE is about 50-64 kDa. (PMID:21356516, PMID: 28972164)

Loading...
||
New chat

Able

正在加载,请稍候...