FDFT1 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83020-5-PBS

  Biolayer interferometry (BLl) kinetic assay of 83020-5-PBS against Human FDFT1 was performed. The affinity constant is below 1 pM.

FDFT1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83020-5-PBS

Clone No.230362H10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

DGPT, EC:2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase, Farnesyl-diphosphate farnesyltransferase 1

---

Product Information

83020-5-PBS targets FDFT1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3743

  Product name: Recombinant human SQS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-358 aa of BC029641

  Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK

• Full Name: farnesyl-diphosphate farnesyltransferase 1
• Calculated Molecular Weight: 417 aa, 48 kDa
• GenBank Accession Number: BC029641
• Gene Symbol: FDFT1
• Gene ID (NCBI): 2222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37268
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.