Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SREBF1 Recombinant monoclonal antibody, PBS Only

SREBF1 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 82684-3-PBS
Clone No.1P4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

1P4, bHLHd1, Class D basic helix-loop-helix protein 1, Processed sterol regulatory element-binding protein 1, SREBF 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82684-3-PBS targets SREBF1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5219

Product name: Recombinant human SREBF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-332 aa of BC063281

Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK

Predict reactive species
Full Name sterol regulatory element binding transcription factor 1
Calculated Molecular Weight 1177 aa, 125 kDa
Observed Molecular Weight68 kDa, 125 kDa
GenBank Accession NumberBC063281
Gene Symbol SREBF1
Gene ID (NCBI) 6720
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36956
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267].

Loading...
||
New chat

Able

正在加载,请稍候...