SREBF2 Recombinant monoclonal antibody, PBS Only

• 

SREBF2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83403-4-PBS

Clone No.240451C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

bHLHd2, Class D basic helix-loop-helix protein 2, Processed sterol regulatory element-binding protein 2, SREBF 2, SREBP 2

---

Product Information

83403-4-PBS targets SREBF2 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28205

  Product name: Recombinant human SREBF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 375-479 aa of BC056158

  Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR

• Full Name: sterol regulatory element binding transcription factor 2
• Calculated Molecular Weight: 124 kDa
• GenBank Accession Number: BC056158
• Gene Symbol: SREBF2
• Gene ID (NCBI): 6721
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12772
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.