• Featured Product
  • KD/KO Validated

SRF Monoclonal antibody, PBS Only (Capture)

SRF Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 66742-1-PBS
Clone No.1G8F4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

1G8F4, MCM1, Serum response factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66742-1-PBS targets SRF as part of a matched antibody pair:

MP51563-1: 66742-1-PBS capture and 66742-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10386

Product name: Recombinant human SRF protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-348 aa of BC048211

Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPG

Predict reactive species
Full Name serum response factor (c-fos serum response element-binding transcription factor)
Calculated Molecular Weight 508 aa, 52 kDa
Observed Molecular Weight65-70 kDa
GenBank Accession NumberBC048211
Gene Symbol SRF
Gene ID (NCBI) 6722
RRIDAB_2882090
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11831
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is required for cardiac differentiation and maturation due to the role in cardiac cell growth and muscle gene regulation. The full-length SRF protein is 67 kDa and molecular weight of cleaved fragment is 50 kDa and 20 kDa (PMID: 21769134).

Loading...
||
New chat Able
正在加载,请稍候...