SRP54 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84014-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 84014-3-PBS against Human SRP54 was performed. The affinity constant is below 1 pM.

SRP54 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84014-3-PBS

Clone No.241125G7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

EC:3.6.5.4, SCN8, Signal recognition particle subunit SRP54

---

Product Information

84014-3-PBS targets SRP54 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2327

  Product name: Recombinant human SRP54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 167-505 aa of BC003389

  Sequence: DPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM

• Full Name: signal recognition particle 54kDa
• Calculated Molecular Weight: 54 kDa
• GenBank Accession Number: BC003389
• Gene Symbol: SRP54
• Gene ID (NCBI): 6729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61011
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.