SRPRB Polyclonal antibody

• 

  WB analysis using 14636-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14636-1-AP (SRPRB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 14636-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14636-1-AP (SRPRB antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14636-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14636-1-AP (SRPRB antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 14636-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14636-1-AP (SRPRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 14636-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14636-1-AP (SRPRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14636-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14636-1-AP (SRPRB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14636-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14636-1-AP (SRPRB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SRPRB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14636-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

APMCF1, Protein APMCF1, SR beta, SRPRB

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HepG2 cells, human liver tissue, HeLa cells, MCF-7 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14636-1-AP targets SRPRB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6215

  Product name: Recombinant human SRPRB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-271 aa of BC065299

  Sequence: MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA

• Full Name: signal recognition particle receptor, B subunit
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC065299
• Gene Symbol: SRPRB
• Gene ID (NCBI): 58477
• RRID: AB_2194868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5M8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; Signal recognition particle receptor-β (SR-β) coordinates cotranslational N-glycosylation; Authors - Chatchai Phoomak