Tested Applications
| Positive WB detected in | human placenta tissue, human kidney tissue, human brain tissue, HepG2 cells |
| Positive IHC detected in | human placenta tissue, human brain tissue, human heart tissue, human kidney tissue, human lung tissue, human skin tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11845-1-AP targets SRPX2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2516 Product name: Recombinant human SRPX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 166-465 aa of BC020733 Sequence: DGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGASCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE Predict reactive species |
| Full Name | sushi-repeat-containing protein, X-linked 2 |
| Calculated Molecular Weight | 465 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC020733 |
| Gene Symbol | SRPX2 |
| Gene ID (NCBI) | 27286 |
| RRID | AB_2195006 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60687 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SRPX2 (sushi-repeat-containing protein, X-linked 2) is a secreted protein expressed in neurons of the human adult brain, including the rolandic area (PMID: 20874700). Firstly described as sushi-repeat protein up-regulated in leukemia (SPRUL) in leukemia cells with dysregulated expression at the transcriptional level, SRPX2 has been recently shown as a multifunctional protein. SRPX2 is a ligand for uPAR, the urokinase-type plasminogen activator (uPA) receptor (PMID: 18718938). It is involved in seizure disorders, angiogenesis and cellular adhesion (PMID: 22242148; 19667118; 16497722). The involvement of SRPX2 in disorders of language cortex and cognition suggests it has an important role in the perisylvian region critical for language development (PMID: 16497722).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SRPX2 antibody 11845-1-AP | Download protocol |
| IHC protocol for SRPX2 antibody 11845-1-AP | Download protocol |
| WB protocol for SRPX2 antibody 11845-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SRPX2 antibody (Cat# 11845-1-AP) has 10 total citations published in journals including Nature Communications, Theranostics, Cell Reports Medicine, FASEB Journal, Human Molecular Genetics, International Journal of Molecular Sciences, Frontiers in Cell and Developmental Biology, Human Cell, Journal of Molecular Histology, and International Journal of Clinical and Experimental Pathology. Research fields span pulmonary fibrosis, neurodegenerative diseases (Alzheimer's, Parkinson's), melanoma, angiogenesis, epilepsy, septic cardiomyopathy, breast cancer, pancreatic cancer, and connective tissue biology.
| Species | Application | Title |
|---|---|---|
Nat Commun Decoding the mechanical characteristics of the human anterior cruciate ligament entheses through graduated mineralization interfaces | ||
Theranostics Local administration of liposomal-based Srpx2 gene therapy reverses pulmonary fibrosis by blockading fibroblast-to-myofibroblast transition.
| ||
Cell Rep Med Universal catalytic endothelial lineage nanovesicles for targeting and rescuing ischemic endothelium | ||
Int J Mol Sci The Role of Lysosomes in a Broad Disease-Modifying Approach Evaluated across Transgenic Mouse Models of Alzheimer's Disease and Parkinson's Disease and Models of Mild Cognitive Impairment. | ||
Front Cell Dev Biol The Landscape of the Tumor Microenvironment in Skin Cutaneous Melanoma Reveals a Prognostic and Immunotherapeutically Relevant Gene Signature. | ||
