SRR Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SRR Polyclonal antibody, PBS Only (17955-1-PBS)

• 

  WB analysis of mouse brain using 17955-1-AP (same clone as 17955-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17955-1-AP (SRR Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17955-1-AP (same clone as 17955-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17955-1-AP (SRR Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17955-1-AP (same clone as 17955-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17955-1-AP (SRR Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 17955-1-AP (same clone as 17955-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 17955-1-AP (SRR Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 17955-1-AP (same clone as 17955-1-PBS)

  IP result of anti-SRR (IP:17955-1-AP, 4ug; Detection:17955-1-AP 1:600) with mouse brain tissue lysate 4000 ug. This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17955-1-AP (same clone as 17955-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17955-1-AP (SRR Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17955-1-AP (same clone as 17955-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17955-1-AP (SRR Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17955-1-AP (same clone as 17955-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17955-1-AP (SRR Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17955-1-AP (same clone as 17955-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17955-1-AP (SRR Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17955-1-PBS in a different storage buffer formulation.

SRR Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17955-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

17955-1-PBS targets SRR in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12449

  Product name: Recombinant human SRR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC074728

  Sequence: MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

• Full Name: serine racemase
• Calculated Molecular Weight: 340 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC074728
• Gene Symbol: SRR
• Gene ID (NCBI): 63826
• RRID: AB_2878471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZT4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SRR(serine racemase) is a 37 kDa protein and belongs to the serine/threonine dehydratase family. It plays a role in neuronal activity and a potential biological role in the regulation of N-methyl-D-aspartate (NMDA) receptor activity in these peripheral organs as well. SRR catalyzes the racemization between l- and d-serine.