SSBP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SSBP3 Polyclonal antibody, PBS Only (33854-1-PBS)

• 

  WB analysis using 33854-1-AP (same clone as 33854-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33854-1-AP (SSBP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33854-1-PBS in a different storage buffer formulation.

SSBP3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33854-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, Indirect ELISA

Synonyms

Sequence-specific single-stranded-DNA-binding protein, Single-stranded DNA-binding protein 3, SSDP, SSDP1

---

Product Information

33854-1-PBS targets SSBP3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40791

  Product name: Recombinant human SSBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 335-388 aa of BC066365

  Sequence: LGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

• Full Name: single stranded DNA binding protein 3
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC066365
• Gene Symbol: SSBP3
• Gene ID (NCBI): 23648
• RRID: AB_3743095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BWW4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SSBP 3 (single-stranded DNA binding protein 3) is a kind of nuclear transcription co-activator. Its core function is to regulate embryonic development, islet β cell function and gene expression by binding single-stranded DNA and participating in transcription regulation complex. Its abnormality is related to diseases such as metabolism and tumor.