SSTR2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87663-1-RR (same clone as 87663-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87663-1-RR (SSTR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87663-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 87663-1-RR (same clone as 87663-1-PBS)

  WB result of SSTR2 antibody (87663-1-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SSTR2 transfected SH-SY5Y cells. This data was developed using the same antibody clone with 87663-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87663-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87663-1-RR against Human SSTR2 were performed. The affinity constant is 0.529 nM.

SSTR2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87663-1-PBS

Clone No.251649C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

somatostatin receptor 2, Somatostatin receptor type 2, SRIF 1, SRIF-1, SS 2 R

---

Product Information

87663-1-PBS targets SSTR2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14205

  Product name: Recombinant human SSTR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of BC019610

  Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG

• Full Name: somatostatin receptor 2
• Calculated Molecular Weight: 369 aa, 41 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC019610
• Gene Symbol: SSTR2
• Gene ID (NCBI): 6752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30874
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Somatostatin receptor 2 (SSTR2) is a G-protein coupled membrane receptor expressed in a variety of neural and neurosecretory tissue types. In neuroendocrine tumors (NETs), in which Somatostatin receptors (SSTRs) are commonly expressed, the detection of SSTR2 expression has both diagnostic and therapeutic potential. Besides NETs, SSTR2 immunostaining can be detected in other types of tumor cells(PMID:34786053). Moreover, SSTR2 is consistently expressed in Olfactory neuroblastoma (ONB) suggesting a role for somatostatin-analog based imaging and therapy in this disease. More generally, SSTR2 may be another marker of neuroendocrine diferentiation in ONB(PMID:33929681).