SSTR5 Polyclonal antibody

• 

  WB analysis of human placenta using 51029-2-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 51029-2-AP (SSTR5 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

SSTR5 Polyclonal Antibody for WB, ELISA

Cat No. 51029-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

somatostatin receptor 5, Somatostatin receptor type 5, SS 5 R, SS5 R, SS5R, SSTR5

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

51029-2-AP targets SSTR5 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0519

  Product name: Recombinant human SSTR5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-54 aa of BC146576

  Sequence: MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAG

• Full Name: somatostatin receptor 5
• Calculated Molecular Weight: 364 aa, 39 kDa
• Observed Molecular Weight: 50 kDa, 65 kDa
• GenBank Accession Number: BC146576
• Gene Symbol: SSTR5
• Gene ID (NCBI): 6755
• RRID: AB_615039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35346
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.