SSU72 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SSU72 Polyclonal antibody (15434-1-AP)

SSU72 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15434-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CTD phosphatase SSU72, EC:3.1.3.16, HSPC182, PNAS 120, PNAS-120

• 

  WB analysis using 15434-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 15434-1-AP (SSU72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293T using 15434-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 15434-1-AP (SSU72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15434-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15434-1-AP (SSU72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SSU72 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells
• Positive IHC detected in: human liver tissue, human breast cancer tissue, human prostate cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15434-1-AP targets SSU72 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7699

  Product name: Recombinant human SSU72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-194 aa of BC008070

  Sequence: SNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

• Full Name: SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC008070
• Gene Symbol: SSU72
• Gene ID (NCBI): 29101
• RRID: AB_2878138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SSU72 Polyclonal antibody (Cat# 15434-1-AP) has 2 citations. One appears in Molecular Cell (IF 16), studying transcriptional termination and pre-mRNA 3′ end processing. The other is in Science Advances (IF 13.9), investigating EIF3D's role in maintaining pluripotency signaling pathways in human cells. The research fields span molecular transcription regulation and stem cell biology/pluripotency.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Mol Cell; Mediator regulates transcriptional termination through crosstalk with pre-mRNA 3' end processing factors; Authors - Chengjiang Lu
human	WB	Sci Adv; EIF3D safeguards the homeostasis of key signaling pathways in human primed pluripotency; Authors - Chikako Okubo