SSU72 Polyclonal antibody

• 

  WB analysis using 15434-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 15434-1-AP (SSU72 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293T using 15434-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 15434-1-AP (SSU72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15434-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15434-1-AP (SSU72 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human kidney using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human breast cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 15434-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 15434-1-AP (SSU72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SSU72 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15434-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

RNA polymerase II subunit A C-terminal domain phosphatase SSU72, PNAS-120, PNAS 120, HSPC182, EC:3.1.3.16

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells
• Positive IHC detected in: human liver tissue, human breast cancer tissue, human prostate cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

15434-1-AP targets SSU72 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7699

  Product name: Recombinant human SSU72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-194 aa of BC008070

  Sequence: SNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

• Full Name: SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC008070
• Gene Symbol: SSU72
• Gene ID (NCBI): 29101
• RRID: AB_2878138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; EIF3D safeguards the homeostasis of key signaling pathways in human primed pluripotency; Authors - Chikako Okubo
		Mol Cell; Mediator regulates transcriptional termination through crosstalk with pre-mRNA 3' end processing factors; Authors - Chengjiang Lu