SSX1 Polyclonal antibody

• 

  WB analysis of PC-3 using 11670-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11670-1-AP (SSX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 11670-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11670-1-AP (SSX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11670-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11670-1-AP (SSX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

SSX1 Polyclonal Antibody for WB, ELISA

Cat No. 11670-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cancer/testis antigen 5.1, CT5.1, Protein SSX1, SSRC, SSX1

---

Tested Applications

• Positive WB detected in: PC-3 cells, HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11670-1-AP targets SSX1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2254

  Product name: Recombinant human SSX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC001003

  Sequence: MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE

• Full Name: synovial sarcoma, X breakpoint 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC001003
• Gene Symbol: SSX1
• Gene ID (NCBI): 6756
• RRID: AB_2877788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16384
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.