SSX4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SSX4 Polyclonal antibody, PBS Only (15876-1-PBS)

• 

  WB analysis of MCF-7 using 15876-1-AP (same clone as 15876-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15876-1-AP (SSX4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15876-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15876-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15876-1-AP (SSX4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 15876-1-AP (same clone as 15876-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 15876-1-AP (SSX4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15876-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15876-1-AP (same clone as 15876-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 15876-1-AP (SSX4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15876-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15876-1-AP (same clone as 15876-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 15876-1-AP (SSX4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15876-1-PBS in a different storage buffer formulation.

SSX4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15876-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

---

Product Information

15876-1-PBS targets SSX4 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8637

  Product name: Recombinant human SSX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC005325

  Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

• Full Name: synovial sarcoma, X breakpoint 4
• Calculated Molecular Weight: 188 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC005325
• Gene Symbol: SSX4
• Gene ID (NCBI): 6759
• RRID: AB_2035018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60224
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.