ST3GAL2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ST3GAL2 Recombinant monoclonal antibody (85634-2-RR)

ST3GAL2 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85634-2-RR

Clone No.253479G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Alpha 2,3-ST 2, Beta-galactoside alpha-2,3-sialyltransferase 2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2, EC:2.4.3.2, EC:2.4.3.4

• 

  WB analysis using 85634-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85634-2-RR (ST3GAL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 85634-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85634-2-RR (ST3GAL2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 85634-2-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85634-2-RR (ST3GAL2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HT-29 cells, NCI-H1299 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85634-2-RR targets ST3GAL2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4528

  Product name: Recombinant human ST3GAL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-210 aa of BC036777

  Sequence: SHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPA

• Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 2
• Calculated Molecular Weight: 350 aa, 40 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: BC036777
• Gene Symbol: ST3GAL2
• Gene ID (NCBI): 6483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16842
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta-galactoside alpha-2,3-sialyltransferase 2 (ST3GAL2) is a sialyltransferase (ST) that transfers sialic acid from the activated donor CMP-sialic acid to the glycan terminus of a glycolipid or glycoprotein. ST3GAL2 contains two putative N-glycosylation sites (Asn92 and Asn211), which are mainly responsible for GD1a and GT1b ganglioside biosynthesis in the brain. ST3GAL2 belongs to the sialyltransferase family, which mediates the terminal modification of glycoproteins and glycolipids. ST3GAL2 has been found to play a role in obesity, aging, and malignant diseases (PMID: 34319453).